(data stored in ACNUC30630 zone)

EMBL: CP001738.PE131

CP001738.PE131       Location/Qualifiers
FT   CDS             143755..144972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0133"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95740"
FT                   /db_xref="GOA:D1AEC4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC4"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACY95740.1"
FT                   /translation="MPEIISVLDPGAPFSKRLAYHRKRSGKTRAVLGGLVGRSAEWVKG
FT                   LETGRLDMPRLPMLLRLADILEVDLFDLTGEARLSQAAYTKHSHPSLDTIKRALTAYPA
FT                   KTTNPVAADVLAGRVQQAWQRWHGQRRERDAIAPLLPGLLADAGAAVRSLQGDERRRAA
FT                   RQLAQIHHLTQLYCAFQPAPELVYMVSDRAMITAQDADDPIAMAGAAWYLNHVWRDVGE
FT                   AAEARVELALDIARMLRPERSTEEQALYALMHLAVALSHAKLGREGEAWQHHDTAYEAV
FT                   RRLPGYIHPWLMIGTGMVEHYAVTIHLDLQKPGRALQAAGRIDPAAVPSRTRQSRYLVE
FT                   VARAHHRQRDPVAAVHLMLKAREASYDTFAFSLFARSMVASMLPDPPATVADEVRDLAG
FT                   TLGLAA"
     MPEIISVLDP GAPFSKRLAY HRKRSGKTRA VLGGLVGRSA EWVKGLETGR LDMPRLPMLL        60
     RLADILEVDL FDLTGEARLS QAAYTKHSHP SLDTIKRALT AYPAKTTNPV AADVLAGRVQ       120
     QAWQRWHGQR RERDAIAPLL PGLLADAGAA VRSLQGDERR RAARQLAQIH HLTQLYCAFQ       180
     PAPELVYMVS DRAMITAQDA DDPIAMAGAA WYLNHVWRDV GEAAEARVEL ALDIARMLRP       240
     ERSTEEQALY ALMHLAVALS HAKLGREGEA WQHHDTAYEA VRRLPGYIHP WLMIGTGMVE       300
     HYAVTIHLDL QKPGRALQAA GRIDPAAVPS RTRQSRYLVE VARAHHRQRD PVAAVHLMLK       360
     AREASYDTFA FSLFARSMVA SMLPDPPATV ADEVRDLAGT LGLAA                       405
//

If you have problems or comments...

PBIL Back to PBIL home page