(data stored in ACNUC30630 zone)

EMBL: CP001738.PE132

CP001738.PE132       Location/Qualifiers
FT   CDS             complement(145645..146388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95741"
FT                   /db_xref="GOA:D1AEC5"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95741.1"
FT                   /translation="MAKKRLISVVLAAMALGGAPAGCGGGEDPDRTGAGESVSPPTASG
FT                   PAVPPSPDQDDRQEARFTADIKKVTAADLRHSWREGCPVPPSRLRAIDMTHWGMDGKVH
FT                   HGRLIVNASAAEDLVGVFRKLFDQKYPIERMEPVDKYRGSDFDSIEANNTSAFNCRQAT
FT                   GSGNWSQHAYGLAIDINPCQNPYVSASGHVAHKDCVKFKDRSRKDPGVIHKGDAVVKAF
FT                   AAIGWGWGGDWTGTKDYQHFSSTGR"
     MAKKRLISVV LAAMALGGAP AGCGGGEDPD RTGAGESVSP PTASGPAVPP SPDQDDRQEA        60
     RFTADIKKVT AADLRHSWRE GCPVPPSRLR AIDMTHWGMD GKVHHGRLIV NASAAEDLVG       120
     VFRKLFDQKY PIERMEPVDK YRGSDFDSIE ANNTSAFNCR QATGSGNWSQ HAYGLAIDIN       180
     PCQNPYVSAS GHVAHKDCVK FKDRSRKDPG VIHKGDAVVK AFAAIGWGWG GDWTGTKDYQ       240
     HFSSTGR                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page