(data stored in ACNUC30630 zone)

EMBL: CP001738.PE133

CP001738.PE133       Location/Qualifiers
FT   CDS             146530..146937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95742"
FT                   /db_xref="GOA:D1AEC6"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95742.1"
FT                   /translation="MTDRQDDKDVPTLEDELFALGSEGADRGRAEPIIRTPAVPPWERL
FT                   AKVDRGDLVRFAAGFATFAFIDLVMMYGPLMGRGDSGMPQFVALLVLAFGLGGMFAWHV
FT                   RGAWRPYGLGMMGGWVALTLLSAGFLTGLMG"
     MTDRQDDKDV PTLEDELFAL GSEGADRGRA EPIIRTPAVP PWERLAKVDR GDLVRFAAGF        60
     ATFAFIDLVM MYGPLMGRGD SGMPQFVALL VLAFGLGGMF AWHVRGAWRP YGLGMMGGWV       120
     ALTLLSAGFL TGLMG                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page