(data stored in ACNUC30630 zone)

EMBL: CP001738.PE135

CP001738.PE135       Location/Qualifiers
FT   CDS             147595..148608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0137"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: bac:BamMC406_2120
FT                   pirin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95744"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC8"
FT                   /inference="protein motif:PFAM:PF05726"
FT                   /protein_id="ACY95744.1"
FT                   /translation="MPAITADPLTLPRLPRMPEAERAGRRVAKVVRARRQLEGEGFVVR
FT                   RPFPGMDLALADPFLLLDHMGAVEYAPGEAKGTPWHPHRGFETVTYIIDGAFQHQDTTG
FT                   GGGLISDGDTQWMTAGAGIQHIEQPPPELVAKGGLFHGVQLWVNLPRAQKWAPPRYQDI
FT                   RATDIKLLSSADGASLVRVIAGSLAGHEGPGITYTPITYLHATVAPGARLTLPWPADFN
FT                   ALLYVLSGRGVAGPEDRPVEEGQLAVFGGSPRTEHGDALTLRAADTQPQASKDGWEVLL
FT                   LGGLPIREPIARYGPFVMNTREEIIQAFEDYQAGRMGQIPAQRVSHRSTADEQGIG"
     MPAITADPLT LPRLPRMPEA ERAGRRVAKV VRARRQLEGE GFVVRRPFPG MDLALADPFL        60
     LLDHMGAVEY APGEAKGTPW HPHRGFETVT YIIDGAFQHQ DTTGGGGLIS DGDTQWMTAG       120
     AGIQHIEQPP PELVAKGGLF HGVQLWVNLP RAQKWAPPRY QDIRATDIKL LSSADGASLV       180
     RVIAGSLAGH EGPGITYTPI TYLHATVAPG ARLTLPWPAD FNALLYVLSG RGVAGPEDRP       240
     VEEGQLAVFG GSPRTEHGDA LTLRAADTQP QASKDGWEVL LLGGLPIREP IARYGPFVMN       300
     TREEIIQAFE DYQAGRMGQI PAQRVSHRST ADEQGIG                                337
//

If you have problems or comments...

PBIL Back to PBIL home page