(data stored in ACNUC30630 zone)

EMBL: CP001738.PE14

CP001738.PE14        Location/Qualifiers
FT   CDS             complement(18333..18656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95623"
FT                   /db_xref="InterPro:IPR040942"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95623.1"
FT                   /translation="MYVITENKNKLRELSQEFENLINELFNQINKNPSIKVLLHGGDSI
FT                   LLEMPRSEIETTVNLIRTTSRGTSFTFSGGYGKTMRDAYLALKLAKATGKNKIIPFTPE
FT                   TLR"
     MYVITENKNK LRELSQEFEN LINELFNQIN KNPSIKVLLH GGDSILLEMP RSEIETTVNL        60
     IRTTSRGTSF TFSGGYGKTM RDAYLALKLA KATGKNKIIP FTPETLR                     107
//

If you have problems or comments...

PBIL Back to PBIL home page