(data stored in ACNUC30630 zone)

EMBL: CP001738.PE141

CP001738.PE141       Location/Qualifiers
FT   CDS             153275..154468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0143"
FT                   /product="ATPase"
FT                   /note="KEGG: geo:Geob_1221 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95750"
FT                   /db_xref="GOA:D1AED4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D1AED4"
FT                   /inference="similar to AA sequence:KEGG:Geob_1221"
FT                   /protein_id="ACY95750.1"
FT                   /translation="MDPVRNPYAPGAGQRPPELAGRDRELQQFEVVLERVARGRPERSM
FT                   IITGLRGVGKTVLLNTFRSMAIQRLWGTGKIEARPEQSIRRPVASALHMAVRELAPRHR
FT                   APERIEYFLGVLKAFAQAGEEPAGKGRARAHRWQPGIDVPAVRGRADSGDLEIDLTELF
FT                   VDAASVATDLGVGIGLFVDEMQDVPAEDISALCAACHELSQVGGPLIVVGAGLPHLPAV
FT                   LSAGKSYSERLFRYARIDRLDRASADRALLAPAERENVTYTPEALEALYEAADGYPYFV
FT                   QAYAKVTWDLAPASPITAEDVKVAAPEAESELAVGFFGSRYERATPAERDYMRTMAMLG
FT                   DDPVPTAAVAEALGRKPSSLSPARDGLIKKGLIYSAERGLVAFTVPHFGKFLRSQPN"
     MDPVRNPYAP GAGQRPPELA GRDRELQQFE VVLERVARGR PERSMIITGL RGVGKTVLLN        60
     TFRSMAIQRL WGTGKIEARP EQSIRRPVAS ALHMAVRELA PRHRAPERIE YFLGVLKAFA       120
     QAGEEPAGKG RARAHRWQPG IDVPAVRGRA DSGDLEIDLT ELFVDAASVA TDLGVGIGLF       180
     VDEMQDVPAE DISALCAACH ELSQVGGPLI VVGAGLPHLP AVLSAGKSYS ERLFRYARID       240
     RLDRASADRA LLAPAERENV TYTPEALEAL YEAADGYPYF VQAYAKVTWD LAPASPITAE       300
     DVKVAAPEAE SELAVGFFGS RYERATPAER DYMRTMAMLG DDPVPTAAVA EALGRKPSSL       360
     SPARDGLIKK GLIYSAERGL VAFTVPHFGK FLRSQPN                                397
//

If you have problems or comments...

PBIL Back to PBIL home page