(data stored in ACNUC30630 zone)

EMBL: CP001738.PE153

CP001738.PE153       Location/Qualifiers
FT   CDS             complement(165962..167140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0155"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; CBS domain containing protein;
FT                   SMART: CBS domain containing protein; KEGG: sat:SYN_00323
FT                   M50 family membrane endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95762"
FT                   /db_xref="GOA:D1AEE6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE6"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ACY95762.1"
FT                   /translation="MNESVRLGRIAGIPVGLNVSVLVIVVILVVGLAFGLFPESFAGYS
FT                   TAAYLLAALLAALAFLASLLAHELAHAVVAKRHGVEVEGITLWLLGGVARLHGEPRTPR
FT                   ADFLIAVVGPLTSVALGAVFWLLALAVGWATGSPLAVGTLVYLALLNVVLAVFNLIPAA
FT                   PLDGGRVLRAALWRWRGDRHAAAISAARAGRAFGFVLITLGLLQVVTGMGVNGLWLALI
FT                   GWFLVNAAAAEEQQTRVQTVLGGVRVGDVMTPHPLTAHPDETVADFIHQVVLARRFSTY
FT                   PLVDELGRLDGLVTLNRIRDVPAALRATTTLREIACPLEGIPLGRPEQPLTELLANMSG
FT                   CTDGRAVVLSPDRRVIGLVTPSDISRAIQVGELTGPYAHRGADVVTLPPRRP"
     MNESVRLGRI AGIPVGLNVS VLVIVVILVV GLAFGLFPES FAGYSTAAYL LAALLAALAF        60
     LASLLAHELA HAVVAKRHGV EVEGITLWLL GGVARLHGEP RTPRADFLIA VVGPLTSVAL       120
     GAVFWLLALA VGWATGSPLA VGTLVYLALL NVVLAVFNLI PAAPLDGGRV LRAALWRWRG       180
     DRHAAAISAA RAGRAFGFVL ITLGLLQVVT GMGVNGLWLA LIGWFLVNAA AAEEQQTRVQ       240
     TVLGGVRVGD VMTPHPLTAH PDETVADFIH QVVLARRFST YPLVDELGRL DGLVTLNRIR       300
     DVPAALRATT TLREIACPLE GIPLGRPEQP LTELLANMSG CTDGRAVVLS PDRRVIGLVT       360
     PSDISRAIQV GELTGPYAHR GADVVTLPPR RP                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page