(data stored in ACNUC30630 zone)

EMBL: CP001738.PE154

CP001738.PE154       Location/Qualifiers
FT   CDS             167376..167585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95763"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95763.1"
FT                   /translation="MSAKPEPGGTPHPVSGRGRPAAPAASAAGSTPRTTAQPTGRSSRS
FT                   RGKDYGMRGNTAHRSEEFSPDDFE"
     MSAKPEPGGT PHPVSGRGRP AAPAASAAGS TPRTTAQPTG RSSRSRGKDY GMRGNTAHRS        60
     EEFSPDDFE                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page