(data stored in ACNUC30630 zone)

EMBL: CP001738.PE155

CP001738.PE155       Location/Qualifiers
FT   CDS             complement(167664..168104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95764"
FT                   /db_xref="GOA:D1AEE8"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95764.1"
FT                   /translation="MRFLTRSHHLPVRLAVGAYVLNSGLSKKNADEETAAGVHGMAAGA
FT                   YPFFKNMDPAVFTRLLSRAEIALGTALLLPFVPSALAGAALTAFSAGLVGLYLRTPGMR
FT                   QEGGLRPTVEGTGLAKDVWLLGIGIGLLIEELAGKDRSRKDG"
     MRFLTRSHHL PVRLAVGAYV LNSGLSKKNA DEETAAGVHG MAAGAYPFFK NMDPAVFTRL        60
     LSRAEIALGT ALLLPFVPSA LAGAALTAFS AGLVGLYLRT PGMRQEGGLR PTVEGTGLAK       120
     DVWLLGIGIG LLIEELAGKD RSRKDG                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page