(data stored in ACNUC30630 zone)

EMBL: CP001738.PE163

CP001738.PE163       Location/Qualifiers
FT   CDS             176582..177142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95772"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEF6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95772.1"
FT                   /translation="MTRRPFRDFDAPRLKEPTWRRPGPPHAAPAPADDLTEAIAELRRT
FT                   FAEWLRDLARQAQNAQGDATETASLLLRLGACAKAAASLTEENPATPRNRPDRRKPERT
FT                   PPPPTRPLHEPRDGPGRHDKSRLKSPARRGPTPLFRSMAPRPRPGVFPNPETPTPGPRP
FT                   GGPGSRRSPPALVPPEPVPWLRP"
     MTRRPFRDFD APRLKEPTWR RPGPPHAAPA PADDLTEAIA ELRRTFAEWL RDLARQAQNA        60
     QGDATETASL LLRLGACAKA AASLTEENPA TPRNRPDRRK PERTPPPPTR PLHEPRDGPG       120
     RHDKSRLKSP ARRGPTPLFR SMAPRPRPGV FPNPETPTPG PRPGGPGSRR SPPALVPPEP       180
     VPWLRP                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page