(data stored in ACNUC30630 zone)

EMBL: CP001738.PE168

CP001738.PE168       Location/Qualifiers
FT   CDS             185271..186794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0171"
FT                   /product="sulfurtransferase DndC"
FT                   /note="TIGRFAM: sulfurtransferase DndC; PFAM:
FT                   phosphoadenosine phosphosulfate reductase; KEGG:
FT                   gur:Gura_2474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95777"
FT                   /db_xref="GOA:D1AEG1"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017598"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEG1"
FT                   /inference="protein motif:TFAM:TIGR03183"
FT                   /protein_id="ACY95777.1"
FT                   /translation="MKVPLGTPTRRAIPFKDRGGLAAVVKELTEEIRELYQADTVPWVV
FT                   GYSGGKDSTAALQLVWLALQDLPVDKRTKPVHVISTDTLVENPIVARWVTQSLVTMAKA
FT                   AEEQQLPIQPHRLTPEVKDTFWVGLIGRGYPAPRPKFRWCTERLKIRPSNSFIRNVVRE
FT                   HGETILVLGIRKAESQARAKAMAKHEKRRVRDRLSPNANLPNSLVYSPIEDWSNDEVWT
FT                   FLMQYPNPWGHENKDLLTMYQGASSDGECPLVVDDTTPSCGDSRFGCWTCTLVDKDKSM
FT                   AAMIQNDEEKEWMLPLLELRNELDVRNEEGYRDDKHLRDWRKMNGTIQLFNDRIVHGPY
FT                   TQQAREQWLRKLLNAQAWIRKNAPENVRDIELITMDELHEIRRIWVFEKHEIEDSLPRI
FT                   YEEETGEKFPGEPLDEHLTLAGDEVEILREVCGDDELHFTTVRELLAVERRFRTMTRRA
FT                   GLFEELEKTIRRGYYQDKDDAEAYALRIRKAQEVPELPLFEEKAADAPA"
     MKVPLGTPTR RAIPFKDRGG LAAVVKELTE EIRELYQADT VPWVVGYSGG KDSTAALQLV        60
     WLALQDLPVD KRTKPVHVIS TDTLVENPIV ARWVTQSLVT MAKAAEEQQL PIQPHRLTPE       120
     VKDTFWVGLI GRGYPAPRPK FRWCTERLKI RPSNSFIRNV VREHGETILV LGIRKAESQA       180
     RAKAMAKHEK RRVRDRLSPN ANLPNSLVYS PIEDWSNDEV WTFLMQYPNP WGHENKDLLT       240
     MYQGASSDGE CPLVVDDTTP SCGDSRFGCW TCTLVDKDKS MAAMIQNDEE KEWMLPLLEL       300
     RNELDVRNEE GYRDDKHLRD WRKMNGTIQL FNDRIVHGPY TQQAREQWLR KLLNAQAWIR       360
     KNAPENVRDI ELITMDELHE IRRIWVFEKH EIEDSLPRIY EEETGEKFPG EPLDEHLTLA       420
     GDEVEILREV CGDDELHFTT VRELLAVERR FRTMTRRAGL FEELEKTIRR GYYQDKDDAE       480
     AYALRIRKAQ EVPELPLFEE KAADAPA                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page