(data stored in ACNUC30630 zone)

EMBL: CP001738.PE191

CP001738.PE191       Location/Qualifiers
FT   CDS             complement(218576..219376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0195"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; MOSC domain
FT                   protein beta barrel domain protein; KEGG: pmy:Pmen_1573
FT                   MOSC domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95800"
FT                   /db_xref="GOA:D1AEI4"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEI4"
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /protein_id="ACY95800.1"
FT                   /translation="MTAVLTGLTVYPLKGGGGTPLTTAELVPTGLRHDREFMLVTPEGR
FT                   FLSQRDLARMALLRPSYDGEVLTVKVADPSLADAPLVHKATDAGPVREVYVHRSQCLGI
FT                   DQGDEAAGWFSALLGTDCRLVRFTGHRATRRADGRVAFADAYPLLLISQESLEDLNGRL
FT                   ERPVPMNRFRPNLVVRGLGAFGEDRVRLLRIGETVIELVKACARCVVITTDQETGERGR
FT                   EPLRTLGSYRAIGRGIRFGQNGVPRTVGTLRVGDAVEVLERRPA"
     MTAVLTGLTV YPLKGGGGTP LTTAELVPTG LRHDREFMLV TPEGRFLSQR DLARMALLRP        60
     SYDGEVLTVK VADPSLADAP LVHKATDAGP VREVYVHRSQ CLGIDQGDEA AGWFSALLGT       120
     DCRLVRFTGH RATRRADGRV AFADAYPLLL ISQESLEDLN GRLERPVPMN RFRPNLVVRG       180
     LGAFGEDRVR LLRIGETVIE LVKACARCVV ITTDQETGER GREPLRTLGS YRAIGRGIRF       240
     GQNGVPRTVG TLRVGDAVEV LERRPA                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page