(data stored in ACNUC30630 zone)

EMBL: CP001738.PE197

CP001738.PE197       Location/Qualifiers
FT   CDS             226208..226660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0201"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   psa:PST_3591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95806"
FT                   /db_xref="GOA:D1AEJ0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEJ0"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACY95806.1"
FT                   /translation="MQAVQIPQRMNLPKVAPKVFSAMLALDAAARQGLDQTLIDLVQIR
FT                   ASQINKCAYCLDYHIADARKAGETEDRIYQLSAWEDAGLYTARERAALALTEAMTLLPG
FT                   GVPDEVYDEAARHFAEAELAQLIALIATINAWNRLNVTTRKTPGTA"
     MQAVQIPQRM NLPKVAPKVF SAMLALDAAA RQGLDQTLID LVQIRASQIN KCAYCLDYHI        60
     ADARKAGETE DRIYQLSAWE DAGLYTARER AALALTEAMT LLPGGVPDEV YDEAARHFAE       120
     AELAQLIALI ATINAWNRLN VTTRKTPGTA                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page