(data stored in ACNUC30630 zone)

EMBL: CP001738.PE202

CP001738.PE202       Location/Qualifiers
FT   CDS             complement(230531..230992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0206"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   pzu:PHZ_c2215 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95811"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEJ5"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACY95811.1"
FT                   /translation="MALPRTYENQNCSIARSLEVVGDRWTLLVIRAAFEGVRRFDDFAE
FT                   HLGVARNVLADRLNRLCAEGIMRKQRYQERPDRYEYRLTRKGVGLWPAMMMLLKWGDRY
FT                   YATDGPPVLVVHRGCGGTLTDRLTCDSCGAPLGPTDVEARPGPGARTSA"
     MALPRTYENQ NCSIARSLEV VGDRWTLLVI RAAFEGVRRF DDFAEHLGVA RNVLADRLNR        60
     LCAEGIMRKQ RYQERPDRYE YRLTRKGVGL WPAMMMLLKW GDRYYATDGP PVLVVHRGCG       120
     GTLTDRLTCD SCGAPLGPTD VEARPGPGAR TSA                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page