(data stored in ACNUC30630 zone)

EMBL: CP001738.PE203

CP001738.PE203       Location/Qualifiers
FT   CDS             complement(231131..232153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0207"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="TIGRFAM: fructose-bisphosphate aldolase, class II;
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II; KEGG: sfu:Sfum_1469
FT                   fructose-bisphosphate aldolase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95812"
FT                   /db_xref="GOA:D1AEJ6"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEJ6"
FT                   /inference="protein motif:TFAM:TIGR01520"
FT                   /protein_id="ACY95812.1"
FT                   /translation="MPIATPEVYAEMLDRAKAEGFAYPAINVTSSQTLNAALRGFAEAE
FT                   SDGIIQISTGGAEYLSGTAVKDMVTGAVAFAEYARVVAAKYPVNIALHTDHCPKEKLDG
FT                   FMRPLVKISQERVAKGQEPLFQSHMWDGSAVELRENLQIAAELLEECVKARTIMEMEIG
FT                   VVGGEEDGIVGEINEKLYTTTEDALATAEAVGVGEKGRYILAATFGNVHGVYKPGHVKL
FT                   RPQVLKEIQEAVGAKYGKDKPFDLVFHGGSGSTLEEIREAVSYGVIKMNIDTDTQYAFT
FT                   RPIADHMFRNYDGVLKVDGEVGNKKTYDPRSYGKAAEAGMAARVVQACQDLMSAGKKLK
FT                   "
     MPIATPEVYA EMLDRAKAEG FAYPAINVTS SQTLNAALRG FAEAESDGII QISTGGAEYL        60
     SGTAVKDMVT GAVAFAEYAR VVAAKYPVNI ALHTDHCPKE KLDGFMRPLV KISQERVAKG       120
     QEPLFQSHMW DGSAVELREN LQIAAELLEE CVKARTIMEM EIGVVGGEED GIVGEINEKL       180
     YTTTEDALAT AEAVGVGEKG RYILAATFGN VHGVYKPGHV KLRPQVLKEI QEAVGAKYGK       240
     DKPFDLVFHG GSGSTLEEIR EAVSYGVIKM NIDTDTQYAF TRPIADHMFR NYDGVLKVDG       300
     EVGNKKTYDP RSYGKAAEAG MAARVVQACQ DLMSAGKKLK                             340
//

If you have problems or comments...

PBIL Back to PBIL home page