(data stored in ACNUC30630 zone)

EMBL: CP001738.PE211

CP001738.PE211       Location/Qualifiers
FT   CDS             complement(236820..237176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU1803 holo-(acyl-carrier-protein)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95820"
FT                   /db_xref="GOA:D1AEK4"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEK4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95820.1"
FT                   /translation="MPHGSIQLEVVSLGAQLRAEADDLLSAAELAYCLGFLRAEEHMGA
FT                   RVAAKRAVSRLLGGDLRHCRHQIELIREDTGPVRVRLHGELLERAQRAGLGVPRVSLTH
FT                   AAGRAAAIAWLGSR"
     MPHGSIQLEV VSLGAQLRAE ADDLLSAAEL AYCLGFLRAE EHMGARVAAK RAVSRLLGGD        60
     LRHCRHQIEL IREDTGPVRV RLHGELLERA QRAGLGVPRV SLTHAAGRAA AIAWLGSR         118
//

If you have problems or comments...

PBIL Back to PBIL home page