(data stored in ACNUC30630 zone)

EMBL: CP001738.PE221

CP001738.PE221       Location/Qualifiers
FT   CDS             246749..247312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0225"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: vcm:VCM66_2567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95830"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEL4"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ACY95830.1"
FT                   /translation="MSLRMAVLGLLAGLGPASGYDLTQRFDASLAFVWYAQHSQIYPEL
FT                   NRLAAEGLIEVAQEGPRGRKTYAITPAGREAVTRWLQHAEPAPTRRNEGALRAFLLPLL
FT                   DPAEAVKVLQREAAFYAERVRELQNLRGLADSAPHRFGRHALELGIRQMTAIREWAEWA
FT                   AQDLAGGTEEVAEKTPESSESAER"
     MSLRMAVLGL LAGLGPASGY DLTQRFDASL AFVWYAQHSQ IYPELNRLAA EGLIEVAQEG        60
     PRGRKTYAIT PAGREAVTRW LQHAEPAPTR RNEGALRAFL LPLLDPAEAV KVLQREAAFY       120
     AERVRELQNL RGLADSAPHR FGRHALELGI RQMTAIREWA EWAAQDLAGG TEEVAEKTPE       180
     SSESAER                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page