(data stored in ACNUC30630 zone)

EMBL: CP001738.PE224

CP001738.PE224       Location/Qualifiers
FT   CDS             250952..251872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0228"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bac:BamMC406_1201 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95833"
FT                   /db_xref="GOA:D1AEL7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEL7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACY95833.1"
FT                   /translation="MTKAGRQPRMDGRVVVVTGAARGLGELLARKLAARGARLALLGLE
FT                   PTRLAEVAESCGEHAGWWEVDVTDDAAMAKAASEIRARYGRVDVVIANAGIATGGPVEH
FT                   SDPRTFARVIEVNLLGSVTTARAFIPALRESKGYFFQVASLAALCAAPMMAAYCASKSG
FT                   VEAFAHSLRAELAAHGVDVGIGYLSWTDTDMVRGADQNEVLRQMRAGLPFPANRTYPLE
FT                   PTVERLVDGIVRRRAHVYGQRWLPAMQLVRGLIPAVVTRHARRVMAEFETRWLAAGGDT
FT                   GLVGAGGAAASAALSEPDRRAASAD"
     MTKAGRQPRM DGRVVVVTGA ARGLGELLAR KLAARGARLA LLGLEPTRLA EVAESCGEHA        60
     GWWEVDVTDD AAMAKAASEI RARYGRVDVV IANAGIATGG PVEHSDPRTF ARVIEVNLLG       120
     SVTTARAFIP ALRESKGYFF QVASLAALCA APMMAAYCAS KSGVEAFAHS LRAELAAHGV       180
     DVGIGYLSWT DTDMVRGADQ NEVLRQMRAG LPFPANRTYP LEPTVERLVD GIVRRRAHVY       240
     GQRWLPAMQL VRGLIPAVVT RHARRVMAEF ETRWLAAGGD TGLVGAGGAA ASAALSEPDR       300
     RAASAD                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page