(data stored in ACNUC30630 zone)

EMBL: CP001738.PE225

CP001738.PE225       Location/Qualifiers
FT   CDS             251902..253221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0229"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   scl:sce5736 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95834"
FT                   /db_xref="GOA:D1A1B2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1B2"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACY95834.1"
FT                   /translation="MLSTMQDARLQIRRLLEHGAALHASATVDTAAPGGLRRVPYARIG
FT                   ADAAALAHALGELGVGEGDRVGTFMWNNAEHLTACLAVPSMGAVLHPLDARLPGEQIVR
FT                   LAEHAEDRVLIADEALLPHLGPLLPQMKTVEHVIVNRAGGTGAGPAVPSGVTVHEYAAL
FT                   LDGRPPAYPWPDLDERAPAAICYAGDGSRAPKGVVHSHRSIYLHALSAAMPDAFGLSSG
FT                   DKVLAVVPPSCALGWGLPYLAFLTGASLAMPDRFQAPQALAGFIAASRPTKGAAPLRVW
FT                   RDLLAHIEADPDADLSSLTEVFADGRPCSPDLLEGYERRGVTLLHVWGAAAAPARPPAD
FT                   ATGAGARHYRLAQGRLPASVQARLVGPDGAALPHDDFSVGELQLRGPWIAGSYHRDEAP
FT                   GDFHDGWLRTGETGRISPDGYLTVTGRLADARRDDHAGAG"
     MLSTMQDARL QIRRLLEHGA ALHASATVDT AAPGGLRRVP YARIGADAAA LAHALGELGV        60
     GEGDRVGTFM WNNAEHLTAC LAVPSMGAVL HPLDARLPGE QIVRLAEHAE DRVLIADEAL       120
     LPHLGPLLPQ MKTVEHVIVN RAGGTGAGPA VPSGVTVHEY AALLDGRPPA YPWPDLDERA       180
     PAAICYAGDG SRAPKGVVHS HRSIYLHALS AAMPDAFGLS SGDKVLAVVP PSCALGWGLP       240
     YLAFLTGASL AMPDRFQAPQ ALAGFIAASR PTKGAAPLRV WRDLLAHIEA DPDADLSSLT       300
     EVFADGRPCS PDLLEGYERR GVTLLHVWGA AAAPARPPAD ATGAGARHYR LAQGRLPASV       360
     QARLVGPDGA ALPHDDFSVG ELQLRGPWIA GSYHRDEAPG DFHDGWLRTG ETGRISPDGY       420
     LTVTGRLADA RRDDHAGAG                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page