(data stored in ACNUC30630 zone)

EMBL: CP001738.PE230

CP001738.PE230       Location/Qualifiers
FT   CDS             complement(257648..260239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0234"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="KEGG: acp:A2cp1_0414 ATP-dependent chaperone ClpB;
FT                   TIGRFAM: ATP-dependent chaperone ClpB; PFAM: ATPase AAA-2
FT                   domain protein; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; Clp
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95839"
FT                   /db_xref="GOA:D1A1B7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1B7"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ACY95839.1"
FT                   /translation="MDYKLTRKSQEAVSIAVRRAAAEGHPQVEPLHLLVALLALPEGTA
FT                   VPLLEAVGADWQAVRSAAEERLARLPRAAGSTVSSPQMSRQLIMAMNTAGNRARQMEDE
FT                   YVSTEHLLVGLAADGGEAAQVLREAGATPQALLEAFEKVRGHARVTSEDPEGTYQALEK
FT                   YGVDLTARAREGKLDPVIGRDTEIRRVVQVLARRTKNNPVLIGEPGVGKTAVVEGLAQR
FT                   IVAGDVPESLKGKRLVALDLGAMVAGAKYRGEFEERLKAVLNEIKSSEGQVITFIDELH
FT                   TVVGAGAAEGAMDAGNMLKPMLARGELRMIGATTLDEYRERIEKDPALERRFQQVFVGE
FT                   PSVEDTIAILRGLKGRYEAHHQVQISDAALVAAAALSDRYITARFLPDKAIDLVDEAAS
FT                   RLRMEIDSRPVEIDELQRTVDRMRMEELALAKESDEASKQRLERLRRDLADKNEQLNAL
FT                   IARWEQEKAGLNRVGELKKRIDQLRGEAERAQRDGDLETSARITYGEIPALEKELKAAA
FT                   EQAEKRDAMVKEEVGPDDVADVVASWTGIPAGRLLEGETAKLLRMEEEIGRRLVGQTQA
FT                   VKAVSDAVRRARAGVSDPDRPTGSFLFLGPTGVGKTELAKALAEFLFDDERAMVRIDMS
FT                   EYSEKHSVARLVGAPPGYVGYEEGGQLTEAVRRRPYCVVLLDEVEKAHPEVFDILLQVL
FT                   DDGRLTDGQGRTVDFRNTILIMTSNLGSQYLVDPTLSSEAKRESVMNTVRASFKPEFLN
FT                   RLDDIILFEALSTEDLTRIVDLQVARLAKRLADRRLKLTVTDAAREWLALTGYDPLYGA
FT                   RPLRRLVQTAIGDQLARELLAGTIGDGDEVVVDLDEAADRLTVKPAASLTK"
     MDYKLTRKSQ EAVSIAVRRA AAEGHPQVEP LHLLVALLAL PEGTAVPLLE AVGADWQAVR        60
     SAAEERLARL PRAAGSTVSS PQMSRQLIMA MNTAGNRARQ MEDEYVSTEH LLVGLAADGG       120
     EAAQVLREAG ATPQALLEAF EKVRGHARVT SEDPEGTYQA LEKYGVDLTA RAREGKLDPV       180
     IGRDTEIRRV VQVLARRTKN NPVLIGEPGV GKTAVVEGLA QRIVAGDVPE SLKGKRLVAL       240
     DLGAMVAGAK YRGEFEERLK AVLNEIKSSE GQVITFIDEL HTVVGAGAAE GAMDAGNMLK       300
     PMLARGELRM IGATTLDEYR ERIEKDPALE RRFQQVFVGE PSVEDTIAIL RGLKGRYEAH       360
     HQVQISDAAL VAAAALSDRY ITARFLPDKA IDLVDEAASR LRMEIDSRPV EIDELQRTVD       420
     RMRMEELALA KESDEASKQR LERLRRDLAD KNEQLNALIA RWEQEKAGLN RVGELKKRID       480
     QLRGEAERAQ RDGDLETSAR ITYGEIPALE KELKAAAEQA EKRDAMVKEE VGPDDVADVV       540
     ASWTGIPAGR LLEGETAKLL RMEEEIGRRL VGQTQAVKAV SDAVRRARAG VSDPDRPTGS       600
     FLFLGPTGVG KTELAKALAE FLFDDERAMV RIDMSEYSEK HSVARLVGAP PGYVGYEEGG       660
     QLTEAVRRRP YCVVLLDEVE KAHPEVFDIL LQVLDDGRLT DGQGRTVDFR NTILIMTSNL       720
     GSQYLVDPTL SSEAKRESVM NTVRASFKPE FLNRLDDIIL FEALSTEDLT RIVDLQVARL       780
     AKRLADRRLK LTVTDAAREW LALTGYDPLY GARPLRRLVQ TAIGDQLARE LLAGTIGDGD       840
     EVVVDLDEAA DRLTVKPAAS LTK                                               863
//

If you have problems or comments...

PBIL Back to PBIL home page