(data stored in ACNUC30630 zone)

EMBL: CP001738.PE234

CP001738.PE234       Location/Qualifiers
FT   CDS             complement(262888..264741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0238"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: gme:Gmet_3532 chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95843"
FT                   /db_xref="GOA:D1A1C1"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1C1"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ACY95843.1"
FT                   /translation="MARAVGIDLGTTNSVVAILEGGEPTVIANAEGSRTTPSVVAFAKN
FT                   GEVLVGEVAKRQAVTNVDRTIRSVKRHMGTDWKIDIDGKKYTPQEISARVLQKLKRDAE
FT                   AYLGEKITDAVITVPAYFSDHQRQATKEAGQIAGLNVLRIINEPTSAALAYHLEKEKEA
FT                   TILVFDLGGGTFDVSLLEVGDGVVEVKATSGDNHLGGDDWDNAIVNWLVERFKNAHGVD
FT                   LSKDKMAMQRLREAAEKAKIELSGATETQINLPYITASSEGPLHLDEKLTRAEFQRMTA
FT                   DLLERCKGPFNQVIKDAGVSVKDIDHVVLVGGSTRMPAVSDLVRELTGGKEPNKGVNPD
FT                   EVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGIFTKIIERNTTIPTKRSEVFT
FT                   TAEDNQPSVEIQVYQGEREIAAYNKKLGTFQLTGLPPAPRGVPQIEVTFDIDANGIVNV
FT                   SAKDLGTGKEQSMVITGGSALPKDEIERMMREAEQHAEEDRKRKEEAEVRNQADTLAYS
FT                   TEKFLRENSEKVPEDVKKEVEEAVADVKKKLEGSDVDAIRASAEKLAQVSQKMGAAMYA
FT                   QSSGEGAQAGGANAQAGSDQGGDDEVVDAEIVDDDKKGGAA"
     MARAVGIDLG TTNSVVAILE GGEPTVIANA EGSRTTPSVV AFAKNGEVLV GEVAKRQAVT        60
     NVDRTIRSVK RHMGTDWKID IDGKKYTPQE ISARVLQKLK RDAEAYLGEK ITDAVITVPA       120
     YFSDHQRQAT KEAGQIAGLN VLRIINEPTS AALAYHLEKE KEATILVFDL GGGTFDVSLL       180
     EVGDGVVEVK ATSGDNHLGG DDWDNAIVNW LVERFKNAHG VDLSKDKMAM QRLREAAEKA       240
     KIELSGATET QINLPYITAS SEGPLHLDEK LTRAEFQRMT ADLLERCKGP FNQVIKDAGV       300
     SVKDIDHVVL VGGSTRMPAV SDLVRELTGG KEPNKGVNPD EVVAVGAALQ AGVLKGEVKD       360
     VLLLDVTPLS LGIETKGGIF TKIIERNTTI PTKRSEVFTT AEDNQPSVEI QVYQGEREIA       420
     AYNKKLGTFQ LTGLPPAPRG VPQIEVTFDI DANGIVNVSA KDLGTGKEQS MVITGGSALP       480
     KDEIERMMRE AEQHAEEDRK RKEEAEVRNQ ADTLAYSTEK FLRENSEKVP EDVKKEVEEA       540
     VADVKKKLEG SDVDAIRASA EKLAQVSQKM GAAMYAQSSG EGAQAGGANA QAGSDQGGDD       600
     EVVDAEIVDD DKKGGAA                                                      617
//

If you have problems or comments...

PBIL Back to PBIL home page