(data stored in ACNUC30630 zone)

EMBL: CP001738.PE243

CP001738.PE243       Location/Qualifiers
FT   CDS             complement(272595..273026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95852"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1D0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95852.1"
FT                   /translation="MNESSLVAGGEAGKRLTAAYAHGPASPSPLVREVLWDFMHSDGGP
FT                   EWTPGADEGYHGRHVRERRRDCESIHWQRRRPPLTRTRVLAHTCECRATIYELCARGGA
FT                   YFIRRTTRGPRGIEVDESPHVIAREAGELWSKPLSGRAR"
     MNESSLVAGG EAGKRLTAAY AHGPASPSPL VREVLWDFMH SDGGPEWTPG ADEGYHGRHV        60
     RERRRDCESI HWQRRRPPLT RTRVLAHTCE CRATIYELCA RGGAYFIRRT TRGPRGIEVD       120
     ESPHVIAREA GELWSKPLSG RAR                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page