(data stored in ACNUC30630 zone)

EMBL: CP001738.PE246

CP001738.PE246       Location/Qualifiers
FT   CDS             274175..275107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0250"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_I2309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95855"
FT                   /db_xref="GOA:D1A1D3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1D3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95855.1"
FT                   /translation="MATGKRREFGAYLARLRGSRSQRALAQLLCELSGTDTLTRHEISR
FT                   WERGKRVPTDWLPYLAQALGVPLTVLERAAAQARDDETPPDGSPVDLSAFFPAGDTLKS
FT                   RITNALHSRAAAGAGGNPVLVLVGGYAGSGKTEFARFLSSISGWAFLDKDALTRRMTER
FT                   LLLTLTGDPHDRHTDTYRREVRPLEYRCLLDAARTNIDCGVSIILAAPFVEEFNNPTWL
FT                   DRLTHRCKAKNVDVVTVWLHCDLDSMHEYIELRDAPRDAWKLANWDQYASTLNTDTSPP
FT                   GAQITIDNRLGAAVSLAEQTHEALRKIIT"
     MATGKRREFG AYLARLRGSR SQRALAQLLC ELSGTDTLTR HEISRWERGK RVPTDWLPYL        60
     AQALGVPLTV LERAAAQARD DETPPDGSPV DLSAFFPAGD TLKSRITNAL HSRAAAGAGG       120
     NPVLVLVGGY AGSGKTEFAR FLSSISGWAF LDKDALTRRM TERLLLTLTG DPHDRHTDTY       180
     RREVRPLEYR CLLDAARTNI DCGVSIILAA PFVEEFNNPT WLDRLTHRCK AKNVDVVTVW       240
     LHCDLDSMHE YIELRDAPRD AWKLANWDQY ASTLNTDTSP PGAQITIDNR LGAAVSLAEQ       300
     THEALRKIIT                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page