(data stored in ACNUC30630 zone)

EMBL: CP001738.PE247

CP001738.PE247       Location/Qualifiers
FT   CDS             complement(276393..277598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0251"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: abo:ABO_1716
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95856"
FT                   /db_xref="GOA:D1A1D4"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1D4"
FT                   /inference="protein motif:PFAM:PF00487"
FT                   /protein_id="ACY95856.1"
FT                   /translation="MPTAASLSRADLEEFGRELDKIRQEVLADLGEDDAAYIRGVIALQ
FT                   RRLEVTGRALLLVSWLPPAWLAGTTALAVAKILENMEIGHNVLHGQWDWMRDPKIHSTT
FT                   WEWDNATPAAQWKHSHNVVHHTWTNVLGKDRDIGYSALRVHPAQQWHPIYLAQPFYNAL
FT                   LALFFEYGIAIYDAELERVAKGEKDAREALRQLRAVAAKAGRQILKDYVAFPLLAGPGM
FT                   LPTLLGNLTANMARNVWAHIVIFCGHFPEGAEVFTEEEIENETRAQWYLRQLLGSCNFD
FT                   GGPLLHLMSGNLSHQIEHHLFPDLPSNRYAQIAPRVRALCARFGLPYNSRPLIKQTCSV
FT                   WKRILRLSLPGGSQAPRPEETTASPGELRATAPKEAPTQAERSPNGDGKEAARKSRGLI
FT                   AR"
     MPTAASLSRA DLEEFGRELD KIRQEVLADL GEDDAAYIRG VIALQRRLEV TGRALLLVSW        60
     LPPAWLAGTT ALAVAKILEN MEIGHNVLHG QWDWMRDPKI HSTTWEWDNA TPAAQWKHSH       120
     NVVHHTWTNV LGKDRDIGYS ALRVHPAQQW HPIYLAQPFY NALLALFFEY GIAIYDAELE       180
     RVAKGEKDAR EALRQLRAVA AKAGRQILKD YVAFPLLAGP GMLPTLLGNL TANMARNVWA       240
     HIVIFCGHFP EGAEVFTEEE IENETRAQWY LRQLLGSCNF DGGPLLHLMS GNLSHQIEHH       300
     LFPDLPSNRY AQIAPRVRAL CARFGLPYNS RPLIKQTCSV WKRILRLSLP GGSQAPRPEE       360
     TTASPGELRA TAPKEAPTQA ERSPNGDGKE AARKSRGLIA R                           401
//

If you have problems or comments...

PBIL Back to PBIL home page