(data stored in ACNUC30630 zone)

EMBL: CP001738.PE256

CP001738.PE256       Location/Qualifiers
FT   CDS             complement(288106..289740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0261"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; adenylate
FT                   cyclase; KEGG: mno:Mnod_4215 CHAD domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95865"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1E3"
FT                   /inference="protein motif:PFAM:PF05235"
FT                   /protein_id="ACY95865.1"
FT                   /translation="MADPKSQLEVERKYDADRDFTLPDLSGLPGVASVSEPRTHVLIAN
FT                   YFDTCDHRLAARGITLRRRRGGADAGWHLKIPVAPDSKNELRASLGRPQVVPAKLARLV
FT                   AVHVRGAQLRPVAVLETERTVILLRDAGGRLLAEVADDTVTGRLIDSEGAEQPGTTVWR
FT                   EIEIELGPAGTPELLRAAGERLQQAGARPASGPAKLGRVLEPVMAVPFGGHRRALPDLP
FT                   AGSAGAAVIGYLAKQVDAVISYDPKARLAEFDAVHKMRVAVRRIRSALRSYAPLLDPVR
FT                   IAPLEPELRWLAEVLGEVRDLEVLRMRFTDRLERPYGLHPAASQSWLEALSKREKSAYR
FT                   RMNTTLTQPRYFALLDALDALVADPPLSERAFRPAVAELPRLVTRQWRRLTRKYEAIAT
FT                   AKDPEEARHDARKAAKRARYAAELAAAALRELKPQAADGARPAKGKGKKRKASRRAAAE
FT                   PARSPAELAEIAAQTAAHAKRLQEVLGGYQDGVIAMQHLRAAAAERSTTPAEAFVLGVL
FT                   YGIERCEALESLSRVEATWEQTAPPAF"
     MADPKSQLEV ERKYDADRDF TLPDLSGLPG VASVSEPRTH VLIANYFDTC DHRLAARGIT        60
     LRRRRGGADA GWHLKIPVAP DSKNELRASL GRPQVVPAKL ARLVAVHVRG AQLRPVAVLE       120
     TERTVILLRD AGGRLLAEVA DDTVTGRLID SEGAEQPGTT VWREIEIELG PAGTPELLRA       180
     AGERLQQAGA RPASGPAKLG RVLEPVMAVP FGGHRRALPD LPAGSAGAAV IGYLAKQVDA       240
     VISYDPKARL AEFDAVHKMR VAVRRIRSAL RSYAPLLDPV RIAPLEPELR WLAEVLGEVR       300
     DLEVLRMRFT DRLERPYGLH PAASQSWLEA LSKREKSAYR RMNTTLTQPR YFALLDALDA       360
     LVADPPLSER AFRPAVAELP RLVTRQWRRL TRKYEAIATA KDPEEARHDA RKAAKRARYA       420
     AELAAAALRE LKPQAADGAR PAKGKGKKRK ASRRAAAEPA RSPAELAEIA AQTAAHAKRL       480
     QEVLGGYQDG VIAMQHLRAA AAERSTTPAE AFVLGVLYGI ERCEALESLS RVEATWEQTA       540
     PPAF                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page