(data stored in ACNUC30630 zone)

EMBL: CP001738.PE265

CP001738.PE265       Location/Qualifiers
FT   CDS             complement(297449..298237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0270"
FT                   /product="SpoOM family protein"
FT                   /note="PFAM: SpoOM family protein; KEGG: vsp:VS_1221
FT                   putative sporulation-control protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95874"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1F2"
FT                   /inference="protein motif:PFAM:PF07070"
FT                   /protein_id="ACY95874.1"
FT                   /translation="MVFKKLLKAMGVGGPSVETVLHNPNTTPGGTISGDVHLMGGEHDS
FT                   DIRYVSVALRTRVEVESGDSEYNTNMEYAKVQLTGPFQLRKGARHSLPFTLQIPWEAPL
FT                   THMYGQPLHGTTVGVATELEVARAVDATDLDPIAVHPLPAQERILAAFANLGFRFRSAD
FT                   CERGYIRGIRQELPFYQEIEFYPPPQYASGINELEVTFVASPHSMEVVLELDKRGGLFT
FT                   EGHDSLTHFTVDYASVHTTNWEHELQQFLNQAARRRGLFF"
     MVFKKLLKAM GVGGPSVETV LHNPNTTPGG TISGDVHLMG GEHDSDIRYV SVALRTRVEV        60
     ESGDSEYNTN MEYAKVQLTG PFQLRKGARH SLPFTLQIPW EAPLTHMYGQ PLHGTTVGVA       120
     TELEVARAVD ATDLDPIAVH PLPAQERILA AFANLGFRFR SADCERGYIR GIRQELPFYQ       180
     EIEFYPPPQY ASGINELEVT FVASPHSMEV VLELDKRGGL FTEGHDSLTH FTVDYASVHT       240
     TNWEHELQQF LNQAARRRGL FF                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page