(data stored in ACNUC30630 zone)

EMBL: CP001738.PE268

CP001738.PE268       Location/Qualifiers
FT   CDS             301310..302035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95877"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1F5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95877.1"
FT                   /translation="MAYFHREPIAVRLGKLADSGRSGVLRVSGDCGGVIYLSEGEVLYA
FT                   ESQRTPALAAWPVIPPDSTGRGASWAEPGAPGSLEWEYSVREATMDAALELIAGSGRNP
FT                   PKHRFRESGTLRIEGTNGIPVPALLAEVERRRRVLEQLSALLTPDTVVVRNPRFDPPAL
FT                   QVSAAQWTLLRHMGDRATPRELALELGCSVFGTTIEVFRLVVLRLLAVAGVPAPPVPAG
FT                   GSAWPDPRRSTVSFLRAVL"
     MAYFHREPIA VRLGKLADSG RSGVLRVSGD CGGVIYLSEG EVLYAESQRT PALAAWPVIP        60
     PDSTGRGASW AEPGAPGSLE WEYSVREATM DAALELIAGS GRNPPKHRFR ESGTLRIEGT       120
     NGIPVPALLA EVERRRRVLE QLSALLTPDT VVVRNPRFDP PALQVSAAQW TLLRHMGDRA       180
     TPRELALELG CSVFGTTIEV FRLVVLRLLA VAGVPAPPVP AGGSAWPDPR RSTVSFLRAV       240
     L                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page