(data stored in ACNUC30630 zone)

EMBL: CP001738.PE269

CP001738.PE269       Location/Qualifiers
FT   CDS             302089..302535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0274"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   bbt:BBta_6136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95878"
FT                   /db_xref="GOA:D1A1F6"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1F6"
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /protein_id="ACY95878.1"
FT                   /translation="MTGPGTETAPLEERLRAELRRLREQVVGVHGSLIATSDGFLVAHD
FT                   TDAEEPSQLAALVATTLGLARQTTQATGRGRFREAVVRGEDGYLAVYALGETAILAVIG
FT                   GEDLNVGMLHYQTRDAAKRMTVLLAGSSWSRYGHNLPYGSFGHR"
     MTGPGTETAP LEERLRAELR RLREQVVGVH GSLIATSDGF LVAHDTDAEE PSQLAALVAT        60
     TLGLARQTTQ ATGRGRFREA VVRGEDGYLA VYALGETAIL AVIGGEDLNV GMLHYQTRDA       120
     AKRMTVLLAG SSWSRYGHNL PYGSFGHR                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page