(data stored in ACNUC30630 zone)

EMBL: CP001738.PE296

CP001738.PE296       Location/Qualifiers
FT   CDS             329999..330376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95905"
FT                   /db_xref="GOA:D1A1I3"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1I3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95905.1"
FT                   /translation="MTVPGYQRSQAPARQSRDGMAMTSLVLGLVGLPALLLCGSGLVMA
FT                   MAGLVLGIVAAHRGGTRGLAVAGIAVCLVTLLVGALGLYWMLTKAARCADVDRYPTELD
FT                   RQRCIEQEFPFARSQSSLEGR"
     MTVPGYQRSQ APARQSRDGM AMTSLVLGLV GLPALLLCGS GLVMAMAGLV LGIVAAHRGG        60
     TRGLAVAGIA VCLVTLLVGA LGLYWMLTKA ARCADVDRYP TELDRQRCIE QEFPFARSQS       120
     SLEGR                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page