(data stored in ACNUC30630 zone)

EMBL: CP001738.PE30

CP001738.PE30        Location/Qualifiers
FT   CDS             35045..36103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0031"
FT                   /product="protein of unknown function DUF405"
FT                   /note="PFAM: protein of unknown function DUF405; protein of
FT                   unknown function DUF418; KEGG: mxa:MXAN_5096 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95639"
FT                   /db_xref="GOA:D1ADC9"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADC9"
FT                   /inference="protein motif:PFAM:PF04171"
FT                   /protein_id="ACY95639.1"
FT                   /translation="MRLEEERRERYGPAASRDDGRPGWARSGRIGELDAVRGLALCGIL
FT                   PANIVAMTGMAGDEIKAEPGVLRHLYECLVHQRFFPVFSVLFGIGAAIFLRTARTGAES
FT                   PRAVLLARLGFLLMFGLAHQLLQPGEVLVYYAVTGIGVLLPATFLPRWAVLACGTAAVL
FT                   ASLLLAGGGVTLIPGLFLLGLAAVDYGVLDLIARRSRRITAAFAVTAPTAAGLGLWQVL
FT                   MGASAFGTPLPAAAGVVTGAAYAMGLLVVLRHERVAAFLSPVLQPLGRLALTNYITASA
FT                   LVLMADRLLDLGGDPRVAALAGTVAGILAAQTVFSRAWLRHYRYGPLEWLWRCLTWWRI
FT                   VPNRLPARPAAG"
     MRLEEERRER YGPAASRDDG RPGWARSGRI GELDAVRGLA LCGILPANIV AMTGMAGDEI        60
     KAEPGVLRHL YECLVHQRFF PVFSVLFGIG AAIFLRTART GAESPRAVLL ARLGFLLMFG       120
     LAHQLLQPGE VLVYYAVTGI GVLLPATFLP RWAVLACGTA AVLASLLLAG GGVTLIPGLF       180
     LLGLAAVDYG VLDLIARRSR RITAAFAVTA PTAAGLGLWQ VLMGASAFGT PLPAAAGVVT       240
     GAAYAMGLLV VLRHERVAAF LSPVLQPLGR LALTNYITAS ALVLMADRLL DLGGDPRVAA       300
     LAGTVAGILA AQTVFSRAWL RHYRYGPLEW LWRCLTWWRI VPNRLPARPA AG               352
//

If you have problems or comments...

PBIL Back to PBIL home page