(data stored in ACNUC30630 zone)

EMBL: CP001738.PE300

CP001738.PE300       Location/Qualifiers
FT   CDS             334270..335223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95909"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1I7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95909.1"
FT                   /translation="METPDSTRGARGVRGGLRRAALALAAAAGALVLTSATATSPAAAE
FT                   PGNEQKIAELTQQIKNLEKEYGGNLEQLRDTRLQAKKALLKVKLLRRDLETARDVVAQL
FT                   AASRYMSNGLDPTVQVLASDDPNRVLSNASLAHHLSVTQAAKVTEINTLLAQQERARRD
FT                   AEKKIKILEKEIADIAKERERVRQLLRRYKPESPMVGTGGMTPRMIKVRDEIEEKFGPF
FT                   PVIGCTRPGDPLDHGSGRACDFMESTAGQMPSPSRLAHGDAVAAYAIRNATRLGIKYII
FT                   WKQRIWDVRSSGGWKMMSDRGSITQNHYDHVHISVF"
     METPDSTRGA RGVRGGLRRA ALALAAAAGA LVLTSATATS PAAAEPGNEQ KIAELTQQIK        60
     NLEKEYGGNL EQLRDTRLQA KKALLKVKLL RRDLETARDV VAQLAASRYM SNGLDPTVQV       120
     LASDDPNRVL SNASLAHHLS VTQAAKVTEI NTLLAQQERA RRDAEKKIKI LEKEIADIAK       180
     ERERVRQLLR RYKPESPMVG TGGMTPRMIK VRDEIEEKFG PFPVIGCTRP GDPLDHGSGR       240
     ACDFMESTAG QMPSPSRLAH GDAVAAYAIR NATRLGIKYI IWKQRIWDVR SSGGWKMMSD       300
     RGSITQNHYD HVHISVF                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page