(data stored in ACNUC30630 zone)

EMBL: CP001738.PE302

CP001738.PE302       Location/Qualifiers
FT   CDS             complement(335869..336141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95911"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1I9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95911.1"
FT                   /translation="MTAAATSASGPASPVGPARSSGLVEPAAEDVAVQKWYLQAVTRVY
FT                   GPWTVSKTISARERALAIRRVRYATDVLADLEARFPRAESRRGWE"
     MTAAATSASG PASPVGPARS SGLVEPAAED VAVQKWYLQA VTRVYGPWTV SKTISARERA        60
     LAIRRVRYAT DVLADLEARF PRAESRRGWE                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page