(data stored in ACNUC30630 zone)

EMBL: CP001738.PE309

CP001738.PE309       Location/Qualifiers
FT   CDS             complement(345743..345991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0316"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: rpb:RPB_3718 phosphoribosylformylglycinamidine
FT                   synthase subunit PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95918"
FT                   /db_xref="GOA:D1A1J6"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1J6"
FT                   /inference="protein motif:TFAM:TIGR00302"
FT                   /protein_id="ACY95918.1"
FT                   /translation="MARVVVDVMLKPEILDPQGRAIARKLPQMNFDGVISVRQGKRFEL
FT                   ELAGPADEAALEKVRQIAATLLVNPVIEDFEVRVLGD"
     MARVVVDVML KPEILDPQGR AIARKLPQMN FDGVISVRQG KRFELELAGP ADEAALEKVR        60
     QIAATLLVNP VIEDFEVRVL GD                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page