(data stored in ACNUC30630 zone)

EMBL: CP001738.PE312

CP001738.PE312       Location/Qualifiers
FT   CDS             349159..349719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0319"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   dol:Dole_1053 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95921"
FT                   /db_xref="GOA:D1A1J9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1J9"
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /protein_id="ACY95921.1"
FT                   /translation="MTAPAARDRSPRIAPGGLRQVGPFTWLLARISGRIAGTGPLALFL
FT                   TLGRHRRLFHAWLWFAGRLMPGGRLPRRESELVILRVAHLRGCRYEWEHHVRLGHRAGL
FT                   GPADIDRVTQGPGAEGWTPRERALLTAADRLHHHRDLDDDTWRLLREHLTEPECIELCM
FT                   LASHYEMLATVIAALRIQPDAPR"
     MTAPAARDRS PRIAPGGLRQ VGPFTWLLAR ISGRIAGTGP LALFLTLGRH RRLFHAWLWF        60
     AGRLMPGGRL PRRESELVIL RVAHLRGCRY EWEHHVRLGH RAGLGPADID RVTQGPGAEG       120
     WTPRERALLT AADRLHHHRD LDDDTWRLLR EHLTEPECIE LCMLASHYEM LATVIAALRI       180
     QPDAPR                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page