(data stored in ACNUC30630 zone)

EMBL: CP001738.PE316

CP001738.PE316       Location/Qualifiers
FT   CDS             complement(353157..353576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95925"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1K3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95925.1"
FT                   /translation="MLKNVHPQVADSGFDSFRQTAAACEGYLIERLLFSRIADSGTLDI
FT                   GLRWGPEKPDITLSFQNVHHFSASGLPDVSAGPLDQITTTVLEPGDEPWPDGLEPGFHR
FT                   SAELPPLLWFHVSGPVRISVLSSTAAAYIEARPSI"
     MLKNVHPQVA DSGFDSFRQT AAACEGYLIE RLLFSRIADS GTLDIGLRWG PEKPDITLSF        60
     QNVHHFSASG LPDVSAGPLD QITTTVLEPG DEPWPDGLEP GFHRSAELPP LLWFHVSGPV       120
     RISVLSSTAA AYIEARPSI                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page