(data stored in ACNUC30630 zone)

EMBL: CP001738.PE324

CP001738.PE324       Location/Qualifiers
FT   CDS             362396..363025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0331"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_5547
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95933"
FT                   /db_xref="GOA:D1A1L1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY95933.1"
FT                   /translation="MNRRRGTSEGGREKILRAALGCFSRDGVAGTPLGRLLSESGVSAG
FT                   SFYHHFTGKEEVAAVLYAETLRGYQEGFLRELRRHADPQAAVAACVAFHIDWCRRHPDH
FT                   ARFLFTERPPGRQEPGGRELADYNRAFYTDVLAWWRQHEHHGALRPLDIVTAYVLWLGP
FT                   AQELCRQWLTGRAPEPSPDQIALLGEAAWQALRQPDSRPSQKGSRT"
     MNRRRGTSEG GREKILRAAL GCFSRDGVAG TPLGRLLSES GVSAGSFYHH FTGKEEVAAV        60
     LYAETLRGYQ EGFLRELRRH ADPQAAVAAC VAFHIDWCRR HPDHARFLFT ERPPGRQEPG       120
     GRELADYNRA FYTDVLAWWR QHEHHGALRP LDIVTAYVLW LGPAQELCRQ WLTGRAPEPS       180
     PDQIALLGEA AWQALRQPDS RPSQKGSRT                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page