(data stored in ACNUC30630 zone)

EMBL: CP001738.PE328

CP001738.PE328       Location/Qualifiers
FT   CDS             366874..367203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0335"
FT                   /product="protein of unknown function DUF466"
FT                   /note="PFAM: protein of unknown function DUF466; KEGG:
FT                   mca:MCA0181 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95937"
FT                   /db_xref="InterPro:IPR007423"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L5"
FT                   /inference="protein motif:PFAM:PF04328"
FT                   /protein_id="ACY95937.1"
FT                   /translation="MTRPPHLFQRVVSAGRLRRRRGLRRGRGLRGDREGSRPRLLGPRV
FT                   ARGSLPERLRSAWRLLREFAGERAYEIYLEHRRRHHPGEPVMSEREFWRRHFDSRGRNP
FT                   GTRCC"
     MTRPPHLFQR VVSAGRLRRR RGLRRGRGLR GDREGSRPRL LGPRVARGSL PERLRSAWRL        60
     LREFAGERAY EIYLEHRRRH HPGEPVMSER EFWRRHFDSR GRNPGTRCC                   109
//

If you have problems or comments...

PBIL Back to PBIL home page