(data stored in ACNUC30630 zone)

EMBL: CP001738.PE33

CP001738.PE33        Location/Qualifiers
FT   CDS             complement(39975..40445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; K11675 Ino eighty
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95642"
FT                   /db_xref="GOA:D1ADD2"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADD2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95642.1"
FT                   /translation="MGVQDDFDLWERELQESAGISWPATGPGGMDDRWPEEEDTGPRPG
FT                   NGTLGELGGNLDGRGDDSVPESPDKPNPGIDDRFAGLGGRKTDPADPHRPDGEFDDEED
FT                   LDARRPGGRAMLAVTGVILLGYLLTLLLGRVPLAVAGLILAGLILLLWRVGL"
     MGVQDDFDLW ERELQESAGI SWPATGPGGM DDRWPEEEDT GPRPGNGTLG ELGGNLDGRG        60
     DDSVPESPDK PNPGIDDRFA GLGGRKTDPA DPHRPDGEFD DEEDLDARRP GGRAMLAVTG       120
     VILLGYLLTL LLGRVPLAVA GLILAGLILL LWRVGL                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page