(data stored in ACNUC30630 zone)

EMBL: CP001738.PE330

CP001738.PE330       Location/Qualifiers
FT   CDS             368292..369491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0337"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95939"
FT                   /db_xref="GOA:D1A1L7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L7"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACY95939.1"
FT                   /translation="MAAGDTPERIGVRIARERKRRGLTQLGLAQRANYSRSHIAQVEAG
FT                   HKMATPAFIAAVAAALGVSPARLYGQPFYENSPVRGAVHTHIPEIRRVLALVDVPPDLE
FT                   GPPRRLTELDAELAMIRRLQVASRYSRIGERLPALLQELSWHAHHTEQARVWHMLFLAQ
FT                   EAAADLCRKLGYHDLAGTCLDRAAESARRAQDPHLPLLVVFRRSLLLLAVAQWRSALTL
FT                   LDRAVRAVDHSREDAAEVLGTAHLRAAIAAARAGDAATAWDHHGQAVEIRRRAGRAPGD
FT                   RHGITTGFVTGNVAIHGAAVAVELGDMDEAVRRDRRIHPRLLADLPPERRAHHEIDMSR
FT                   ALLETGDYGRALQRLEKAEQIAPQLTYFHPSARSAVAHLVDVRRTLPEPLRRLQSHMGV
FT                   "
     MAAGDTPERI GVRIARERKR RGLTQLGLAQ RANYSRSHIA QVEAGHKMAT PAFIAAVAAA        60
     LGVSPARLYG QPFYENSPVR GAVHTHIPEI RRVLALVDVP PDLEGPPRRL TELDAELAMI       120
     RRLQVASRYS RIGERLPALL QELSWHAHHT EQARVWHMLF LAQEAAADLC RKLGYHDLAG       180
     TCLDRAAESA RRAQDPHLPL LVVFRRSLLL LAVAQWRSAL TLLDRAVRAV DHSREDAAEV       240
     LGTAHLRAAI AAARAGDAAT AWDHHGQAVE IRRRAGRAPG DRHGITTGFV TGNVAIHGAA       300
     VAVELGDMDE AVRRDRRIHP RLLADLPPER RAHHEIDMSR ALLETGDYGR ALQRLEKAEQ       360
     IAPQLTYFHP SARSAVAHLV DVRRTLPEPL RRLQSHMGV                              399
//

If you have problems or comments...

PBIL Back to PBIL home page