(data stored in ACNUC30630 zone)

EMBL: CP001738.PE331

CP001738.PE331       Location/Qualifiers
FT   CDS             369764..370957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0338"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: bid:Bind_2413
FT                   helix-turn-helix domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95940"
FT                   /db_xref="GOA:D1A1L8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L8"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACY95940.1"
FT                   /translation="MVADAAPERIGIRIARERKRRGLTQLGLAQRANYSRSHIAQVEAR
FT                   HKAATPAFVAAVAEALEVDPALIYGQPYRGVGSDDKAHAAIPELRRILACVGAGPEPDR
FT                   PPRGLDELERQIRQARRLLLQVRLTRLGMMLPAVLEELTWHAYETDSPKAWGLLFRAYY
FT                   EAVSLTRRLGYTGDALALLERAADAARRSQDPHLPLLVSLPRALLLMSMNQNRTALRLL
FT                   NDALSRVEADRPDAGEVAGALELRAAVVAARTCDGVSEAWEHHGRAAELAEAGRVGDGR
FT                   HGMEFGMSNVAVHGAAIAVELGDLDEAVRRDRDIRQRQVLEGMAPERRAHHEIDMSRAL
FT                   LELGDYDQALARVENAERIASQMTYFHPSARSVVAHLVDVRRTLPEPLRRLQSRMGV"
     MVADAAPERI GIRIARERKR RGLTQLGLAQ RANYSRSHIA QVEARHKAAT PAFVAAVAEA        60
     LEVDPALIYG QPYRGVGSDD KAHAAIPELR RILACVGAGP EPDRPPRGLD ELERQIRQAR       120
     RLLLQVRLTR LGMMLPAVLE ELTWHAYETD SPKAWGLLFR AYYEAVSLTR RLGYTGDALA       180
     LLERAADAAR RSQDPHLPLL VSLPRALLLM SMNQNRTALR LLNDALSRVE ADRPDAGEVA       240
     GALELRAAVV AARTCDGVSE AWEHHGRAAE LAEAGRVGDG RHGMEFGMSN VAVHGAAIAV       300
     ELGDLDEAVR RDRDIRQRQV LEGMAPERRA HHEIDMSRAL LELGDYDQAL ARVENAERIA       360
     SQMTYFHPSA RSVVAHLVDV RRTLPEPLRR LQSRMGV                                397
//

If you have problems or comments...

PBIL Back to PBIL home page