(data stored in ACNUC30630 zone)

EMBL: CP001738.PE334

CP001738.PE334       Location/Qualifiers
FT   CDS             371972..372904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0341"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   spe:Spro_0372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95943"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2C3"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACY95943.1"
FT                   /translation="MRWPLGRPRMDAFAGLVGVPVAEGDGGVSGMFLGTSSVLLRDGDT
FT                   ALLTDGFFTRPGWLRVGLGRIAPDREVIDACLRRAGIGHAGSLAAVICVHSHYDHAMDA
FT                   PVIAERLGAKLVGSHSSANIGRGHGLPEEALRTVEDGETVRFGDFEVTFVVGVHCPGDL
FT                   APGAIDAPLSPPARARAYRTGEAYSVFFRHPLGTVLVHGSAGFVPGRLDGHRADIVYLG
FT                   IGQLGKQDDDYRRRYWAEIVRATGAEVVIPIHWDDFTTPLLTAPLRPFPYFADDVAVSM
FT                   RFLVEQSRRDGVRLVLPDLWRETTLLPVR"
     MRWPLGRPRM DAFAGLVGVP VAEGDGGVSG MFLGTSSVLL RDGDTALLTD GFFTRPGWLR        60
     VGLGRIAPDR EVIDACLRRA GIGHAGSLAA VICVHSHYDH AMDAPVIAER LGAKLVGSHS       120
     SANIGRGHGL PEEALRTVED GETVRFGDFE VTFVVGVHCP GDLAPGAIDA PLSPPARARA       180
     YRTGEAYSVF FRHPLGTVLV HGSAGFVPGR LDGHRADIVY LGIGQLGKQD DDYRRRYWAE       240
     IVRATGAEVV IPIHWDDFTT PLLTAPLRPF PYFADDVAVS MRFLVEQSRR DGVRLVLPDL       300
     WRETTLLPVR                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page