(data stored in ACNUC30630 zone)

EMBL: CP001738.PE335

CP001738.PE335       Location/Qualifiers
FT   CDS             complement(373020..374018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0342"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dal:Dalk_4058 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95944"
FT                   /db_xref="GOA:D1A2C4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2C4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY95944.1"
FT                   /translation="MLSLRSLSVGYPGRRRRPARRVLEGLEAVARPGDLTVLIGPNGTG
FT                   KSTLLRTLAGLQPALEGQVLLDGSPITALDEVERARRIAVVLTERDLPALLTARELTGL
FT                   GRHPHTGFTGRLTAADQAVIDWALQVTGAAHLAHRPVTELSDGERQRVLTARALAQEPS
FT                   AILLDEPTAFLDVPSRVALMGLLRRLARERSLVVVVSTHDLELALRIADRIWLIDPAGA
FT                   LHCGTPEELTLNGTIGASFDGEELTFEAASGVFVLHGKGRGTARVTADGTRRPLLERAL
FT                   TRAGWHPSPEGPADLAVTWTGEAYEAVRDGTAHRFTSLADLTDWARHEANR"
     MLSLRSLSVG YPGRRRRPAR RVLEGLEAVA RPGDLTVLIG PNGTGKSTLL RTLAGLQPAL        60
     EGQVLLDGSP ITALDEVERA RRIAVVLTER DLPALLTARE LTGLGRHPHT GFTGRLTAAD       120
     QAVIDWALQV TGAAHLAHRP VTELSDGERQ RVLTARALAQ EPSAILLDEP TAFLDVPSRV       180
     ALMGLLRRLA RERSLVVVVS THDLELALRI ADRIWLIDPA GALHCGTPEE LTLNGTIGAS       240
     FDGEELTFEA ASGVFVLHGK GRGTARVTAD GTRRPLLERA LTRAGWHPSP EGPADLAVTW       300
     TGEAYEAVRD GTAHRFTSLA DLTDWARHEA NR                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page