(data stored in ACNUC30630 zone)

EMBL: CP001738.PE337

CP001738.PE337       Location/Qualifiers
FT   CDS             complement(375087..376400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0344"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   dal:Dalk_4056 ABC-type Fe3+-hydroxamate transport system
FT                   periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95946"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2C6"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACY95946.1"
FT                   /translation="MNLVHRAGRTPAERQPDPSLPHRPEAGRPAEGGSSRTFRTRRAWP
FT                   LATALVALSLVASACGGDGQGSQAAQDDRCVKEFDASKDYFPVKQTIRHATNFTLTYAK
FT                   NYQVVTVKQPAPGAKPQTYVLVRCGTPAPKAEGELKDAVVVETPVRTLFASSTTHLPFI
FT                   TDLGVLDRLKGVASAGLITSPQVRERVAAKQIIEYADITGQEIDTEKVIGARPDVLMTD
FT                   GNDVPAHQTLRNAGIKIVANAEWQETSALGRAEWIKFVAALTGTEAKATEVFDKVAAAY
FT                   QELAAKAKQAEPVSVLPGQMFQGQWAIPNGESFMAKLIADAGGTYAWADTKGTGSTNLD
FT                   LETVLSKARDAEVWLPQMNDWKSLEDVRKADPRYAEFAAFKSGKVWSMNKVLGPGGGND
FT                   FYERGVGRPDLILADLVAILHPELMPGHTFTFYQQLAR"
     MNLVHRAGRT PAERQPDPSL PHRPEAGRPA EGGSSRTFRT RRAWPLATAL VALSLVASAC        60
     GGDGQGSQAA QDDRCVKEFD ASKDYFPVKQ TIRHATNFTL TYAKNYQVVT VKQPAPGAKP       120
     QTYVLVRCGT PAPKAEGELK DAVVVETPVR TLFASSTTHL PFITDLGVLD RLKGVASAGL       180
     ITSPQVRERV AAKQIIEYAD ITGQEIDTEK VIGARPDVLM TDGNDVPAHQ TLRNAGIKIV       240
     ANAEWQETSA LGRAEWIKFV AALTGTEAKA TEVFDKVAAA YQELAAKAKQ AEPVSVLPGQ       300
     MFQGQWAIPN GESFMAKLIA DAGGTYAWAD TKGTGSTNLD LETVLSKARD AEVWLPQMND       360
     WKSLEDVRKA DPRYAEFAAF KSGKVWSMNK VLGPGGGNDF YERGVGRPDL ILADLVAILH       420
     PELMPGHTFT FYQQLAR                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page