(data stored in ACNUC30630 zone)

EMBL: CP001738.PE342

CP001738.PE342       Location/Qualifiers
FT   CDS             380431..381477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_4664 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95951"
FT                   /db_xref="InterPro:IPR021243"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D1"
FT                   /inference="similar to AA sequence:KEGG:PSPA7_4664"
FT                   /protein_id="ACY95951.1"
FT                   /translation="MSTTEREITEPVELCLPDGRLNPAAAGWTRRPLHTCRLRGWGRTK
FT                   RWEYWCVTTPTHLLAVTVSDLDFLALNSVYFLEYGGFEFERTALVPFGRGVSLPPVIAG
FT                   TPGDPSTDVVVGPERPTGGQVRVEITALPGGTRLRARCLTPDRRPLEADLEVALPAGHE
FT                   TLGVVVPWSDRRFQYTAKHTARPATGTVRIGSSTYEFGEDAWGVLDHGRGRWPHSITWN
FT                   WGAASGRSGGHVVGLQLGGKWTEGTGATENALCVDGRLTKIGQELQWRYDPGDFLAPWT
FT                   IRTPDGEQVDLTFTPFHDRVVRTNAVLLANRTDQCFGRYHGRVRTDDGRDVPIDGLLGW
FT                   AEEVRMRW"
     MSTTEREITE PVELCLPDGR LNPAAAGWTR RPLHTCRLRG WGRTKRWEYW CVTTPTHLLA        60
     VTVSDLDFLA LNSVYFLEYG GFEFERTALV PFGRGVSLPP VIAGTPGDPS TDVVVGPERP       120
     TGGQVRVEIT ALPGGTRLRA RCLTPDRRPL EADLEVALPA GHETLGVVVP WSDRRFQYTA       180
     KHTARPATGT VRIGSSTYEF GEDAWGVLDH GRGRWPHSIT WNWGAASGRS GGHVVGLQLG       240
     GKWTEGTGAT ENALCVDGRL TKIGQELQWR YDPGDFLAPW TIRTPDGEQV DLTFTPFHDR       300
     VVRTNAVLLA NRTDQCFGRY HGRVRTDDGR DVPIDGLLGW AEEVRMRW                    348
//

If you have problems or comments...

PBIL Back to PBIL home page