(data stored in ACNUC30630 zone)

EMBL: CP001738.PE344

CP001738.PE344       Location/Qualifiers
FT   CDS             383172..384263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0351"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase subunit II; KEGG:
FT                   gme:Gmet_1929 cytochrome bd ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95953"
FT                   /db_xref="GOA:D1A2D3"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D3"
FT                   /inference="protein motif:TFAM:TIGR00203"
FT                   /protein_id="ACY95953.1"
FT                   /translation="MELTTVWFLLIAVLWAGYFLLEGFDFGVGVLMPVLAPRKAAHSDT
FT                   DRRVMINTIGPVWDGNEVWLLVAGGATFAAFPEWYASLFSGFYLALLLILAALIVRGVA
FT                   FEYRGKVDSDRWRRNWDLAIFWGSAVPALLWGVAFANILQGVPLDAQHHYTGTLLTLLN
FT                   PYALLGGLTTLTVFTLHGAVFLALKTRGHVRDQARRAVRYLAAPTVAIAAAFLVITGVR
FT                   FGVPWTWATTAVAALALAGGVAAALRGRDGWAFTGTAVAIVATVATMFGDLWPAVLPST
FT                   IDPAYSLTVENAASTPYTLKVMTWVAVIFTPIVLAYQAWTYWVFRKRLTREAIVPPAPS
FT                   GDGAPARPAKAHEPEHAVERSRA"
     MELTTVWFLL IAVLWAGYFL LEGFDFGVGV LMPVLAPRKA AHSDTDRRVM INTIGPVWDG        60
     NEVWLLVAGG ATFAAFPEWY ASLFSGFYLA LLLILAALIV RGVAFEYRGK VDSDRWRRNW       120
     DLAIFWGSAV PALLWGVAFA NILQGVPLDA QHHYTGTLLT LLNPYALLGG LTTLTVFTLH       180
     GAVFLALKTR GHVRDQARRA VRYLAAPTVA IAAAFLVITG VRFGVPWTWA TTAVAALALA       240
     GGVAAALRGR DGWAFTGTAV AIVATVATMF GDLWPAVLPS TIDPAYSLTV ENAASTPYTL       300
     KVMTWVAVIF TPIVLAYQAW TYWVFRKRLT REAIVPPAPS GDGAPARPAK AHEPEHAVER       360
     SRA                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page