(data stored in ACNUC30630 zone)

EMBL: CP001738.PE349

CP001738.PE349       Location/Qualifiers
FT   CDS             389045..390106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0356"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   atc:AGR_pAT_449 ferric enterobactin transport protein FepD"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95958"
FT                   /db_xref="GOA:D1A2D8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D8"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACY95958.1"
FT                   /translation="MLTPVREAPLRDDPPQPAVAGALRRGRVAGLFLLAGLLVLIVMAS
FT                   FAIGAERVPLSRVLPGIFEPDGSQSALIIQEMRLPRTLLGLAVGASLGLAGALMQALTR
FT                   NPLAEPGVLGVNGGAALAVVLLIWLADVDQVLVYVWAAFAGAAGAVLLVYMIGSYGRAG
FT                   ATPGRLVLAGAALNAVFSALTNGVMLLDPHGFNSFRFWQVGSLAGRDLATLAQVGPFMA
FT                   AGVLLALSLARSLNVLALGEEAGRALGGSLGRTRALGALAVVLLSGAATAAVGPIAFLG
FT                   LAVPFIVRALVGPDQRWVLPYSLLLAPVLLLGADIVGRVVAPPAELETGIVTAFLGAPI
FT                   FIMLVRRGRMPKL"
     MLTPVREAPL RDDPPQPAVA GALRRGRVAG LFLLAGLLVL IVMASFAIGA ERVPLSRVLP        60
     GIFEPDGSQS ALIIQEMRLP RTLLGLAVGA SLGLAGALMQ ALTRNPLAEP GVLGVNGGAA       120
     LAVVLLIWLA DVDQVLVYVW AAFAGAAGAV LLVYMIGSYG RAGATPGRLV LAGAALNAVF       180
     SALTNGVMLL DPHGFNSFRF WQVGSLAGRD LATLAQVGPF MAAGVLLALS LARSLNVLAL       240
     GEEAGRALGG SLGRTRALGA LAVVLLSGAA TAAVGPIAFL GLAVPFIVRA LVGPDQRWVL       300
     PYSLLLAPVL LLGADIVGRV VAPPAELETG IVTAFLGAPI FIMLVRRGRM PKL              353
//

If you have problems or comments...

PBIL Back to PBIL home page