(data stored in ACNUC30630 zone)

EMBL: CP001738.PE35

CP001738.PE35        Location/Qualifiers
FT   CDS             40920..41012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95644"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADD4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95644.1"
FT                   /translation="MPPWAASLPVIAPKQPGCTGRGPFAAARLP"
     MPPWAASLPV IAPKQPGCTG RGPFAAARLP                                         30
//

If you have problems or comments...

PBIL Back to PBIL home page