(data stored in ACNUC30630 zone)

EMBL: CP001738.PE352

CP001738.PE352       Location/Qualifiers
FT   CDS             392042..395437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0359"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase; Non- ribosomal
FT                   peptide synthetase; phosphopantetheine-binding;
FT                   condensation domain protein; KEGG: pfl:PFL_3493 pyochelin
FT                   synthetase E"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95961"
FT                   /db_xref="GOA:D1A2E1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E1"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ACY95961.1"
FT                   /translation="MLTREELHQSLTQVLGEQVDPHDNLIELGMDSIRLMSLTGRLRKR
FT                   GIEITFAELAERPTLAQWWELLAERGALAPAAEPETPQEPAADAQEPDGPFPLALMQHA
FT                   YWIGRDSEQELGSVAAHLYVELDGRDIDPGRLEKAVRTLVERHPMLRVAICDDGTQRVL
FT                   PERPGPAITVLDLRRAADPQAELERVRREMSTQRLPIDTGKVFDLRLSLLPSGTARLHL
FT                   DVDMVAADAMSYRTMLADLAALYEGETLPPLRYSYARYLAADPRAQARERDRAWWAQRL
FT                   ADLPGPPELPVVPKPGHRVVRKHHWLSPEGKRQLITRAHREGVTPAMALATIFAEVIGA
FT                   WSATPRFILNLPLFHREPVHPDVDKLVGDFTGSILLEIDLTEELPFVERARAVQAKLHT
FT                   AGTHSDYSGLEVLRDLSRQRGEQVLAPIVYTSALNLGELFDERVRALFGEPVWIISQGP
FT                   QVLLDAQVTEVSGGLLLNWDVREPAFPEGVADAMFAAYTDAVTRLGAPDADWSRPLRIQ
FT                   APPEQLEIRKRLNARPAPPSRTLIEGFFANARHNPQAPAVHWDDDGTLTYGELADRALR
FT                   VAGHLVAQGVRPGDRVAIELPKGPDQAVAVLGVLAAGAAYVPIGVEQPPARREKITKTA
FT                   QIALSLTPAALTWALAQAQPLAEPVPITPGQVAYVLFTSGSTGEPKGVEVSHRAAMNTI
FT                   GDLIERFSLGPRDVSLGISALDFDLSVFDLFALWTAGGAVVIPAEEERKDAARWAELVA
FT                   RRSVTVLNCVPSVLEMLLQTGGDVRSLRVVLLGGDWVGVHLPGMLAERAPGCRFVALGG
FT                   TTETAIHSTVQEVSGPVPEDWHAVPYGVPLRGVACRVVDEQGRDRPDWVPGELWIGGGG
FT                   VAEGYCGDPERTADRFVTHEGVRWYRTGDMARYRPDGTLEFLGRRDHQVKVRGFRIELG
FT                   EIEAALESHPRVRRAVALLAGSRLAAAIVPASGEVDRQELQDHVRDLLPPHMVPELLVR
FT                   VEELPLTANGKIDRKALTALAAAEAGEAAATYVEPTTALEKVIARTIGEVLGIERVGAE
FT                   DDFFALGGDSVLATTVVARLREALDTTSLPVRVIFAQRTVSRIARRFTELEETPGRLEA
FT                   VADIWLTVADMTDEEVEAHLSGSA"
     MLTREELHQS LTQVLGEQVD PHDNLIELGM DSIRLMSLTG RLRKRGIEIT FAELAERPTL        60
     AQWWELLAER GALAPAAEPE TPQEPAADAQ EPDGPFPLAL MQHAYWIGRD SEQELGSVAA       120
     HLYVELDGRD IDPGRLEKAV RTLVERHPML RVAICDDGTQ RVLPERPGPA ITVLDLRRAA       180
     DPQAELERVR REMSTQRLPI DTGKVFDLRL SLLPSGTARL HLDVDMVAAD AMSYRTMLAD       240
     LAALYEGETL PPLRYSYARY LAADPRAQAR ERDRAWWAQR LADLPGPPEL PVVPKPGHRV       300
     VRKHHWLSPE GKRQLITRAH REGVTPAMAL ATIFAEVIGA WSATPRFILN LPLFHREPVH       360
     PDVDKLVGDF TGSILLEIDL TEELPFVERA RAVQAKLHTA GTHSDYSGLE VLRDLSRQRG       420
     EQVLAPIVYT SALNLGELFD ERVRALFGEP VWIISQGPQV LLDAQVTEVS GGLLLNWDVR       480
     EPAFPEGVAD AMFAAYTDAV TRLGAPDADW SRPLRIQAPP EQLEIRKRLN ARPAPPSRTL       540
     IEGFFANARH NPQAPAVHWD DDGTLTYGEL ADRALRVAGH LVAQGVRPGD RVAIELPKGP       600
     DQAVAVLGVL AAGAAYVPIG VEQPPARREK ITKTAQIALS LTPAALTWAL AQAQPLAEPV       660
     PITPGQVAYV LFTSGSTGEP KGVEVSHRAA MNTIGDLIER FSLGPRDVSL GISALDFDLS       720
     VFDLFALWTA GGAVVIPAEE ERKDAARWAE LVARRSVTVL NCVPSVLEML LQTGGDVRSL       780
     RVVLLGGDWV GVHLPGMLAE RAPGCRFVAL GGTTETAIHS TVQEVSGPVP EDWHAVPYGV       840
     PLRGVACRVV DEQGRDRPDW VPGELWIGGG GVAEGYCGDP ERTADRFVTH EGVRWYRTGD       900
     MARYRPDGTL EFLGRRDHQV KVRGFRIELG EIEAALESHP RVRRAVALLA GSRLAAAIVP       960
     ASGEVDRQEL QDHVRDLLPP HMVPELLVRV EELPLTANGK IDRKALTALA AAEAGEAAAT      1020
     YVEPTTALEK VIARTIGEVL GIERVGAEDD FFALGGDSVL ATTVVARLRE ALDTTSLPVR      1080
     VIFAQRTVSR IARRFTELEE TPGRLEAVAD IWLTVADMTD EEVEAHLSGS A               1131
//

If you have problems or comments...

PBIL Back to PBIL home page