(data stored in ACNUC30630 zone)

EMBL: CP001738.PE356

CP001738.PE356       Location/Qualifiers
FT   CDS             complement(398919..400286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0363"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cvi:CV_2237 enterobactin exporter EntS"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95965"
FT                   /db_xref="GOA:D1A2E5"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACY95965.1"
FT                   /translation="MLRRLALDVSPLRTSRPFRNVFIARTVSVFGIGMLMVALPVQVHQ
FT                   MTGSTLHVGAVSGTGGLALLAGLLWGGVMADRNDRRTLMLRGRIAAGIGFALLALNAFL
FT                   PSPSLAALYVLAAWDGVTTGISLTALLAATPALVGPDKLVAAGALNALTVRLGSMLSPA
FT                   LGGVVISAFGVGWNYTAAAAGTFGTLGLLTALPPLKPGGPPVVAGAGESGALGKTAETA
FT                   EAAAGSGGAVPAAQNTEADEETGGAEAAHPLRAIGAGLRFVAGHRVVGGLMLLGLLFMV
FT                   AGGIPVLMPAFATEQLGGGPTTVGLLYAAPACGAVLASVTSGWTSALRAPGRVLLIASV
FT                   AGFVILACLGLARHPALAVAVLFGYGFVASIEEILRYGLIQTHTPDGYLGRVNALWSAQ
FT                   DTAGEAVGSVSAGALGRYLAPGDAIVVYGAVSAVLALILAVFLTGLRTATLRPETA"
     MLRRLALDVS PLRTSRPFRN VFIARTVSVF GIGMLMVALP VQVHQMTGST LHVGAVSGTG        60
     GLALLAGLLW GGVMADRNDR RTLMLRGRIA AGIGFALLAL NAFLPSPSLA ALYVLAAWDG       120
     VTTGISLTAL LAATPALVGP DKLVAAGALN ALTVRLGSML SPALGGVVIS AFGVGWNYTA       180
     AAAGTFGTLG LLTALPPLKP GGPPVVAGAG ESGALGKTAE TAEAAAGSGG AVPAAQNTEA       240
     DEETGGAEAA HPLRAIGAGL RFVAGHRVVG GLMLLGLLFM VAGGIPVLMP AFATEQLGGG       300
     PTTVGLLYAA PACGAVLASV TSGWTSALRA PGRVLLIASV AGFVILACLG LARHPALAVA       360
     VLFGYGFVAS IEEILRYGLI QTHTPDGYLG RVNALWSAQD TAGEAVGSVS AGALGRYLAP       420
     GDAIVVYGAV SAVLALILAV FLTGLRTATL RPETA                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page