(data stored in ACNUC30630 zone)

EMBL: CP001738.PE357

CP001738.PE357       Location/Qualifiers
FT   CDS             400364..400771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0364"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: mxa:MXAN_6830 aspartate 1-decarboxylase;
FT                   TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95966"
FT                   /db_xref="GOA:D1A2E6"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E6"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ACY95966.1"
FT                   /translation="MRRTLMNGKIHRATVTQANLHYVGSLTIDADLMAAADIVEGEQVQ
FT                   VVDVTNGARLVTYAITGEAGSGVIGINGAAAHLVKPGDMVIIISYVALTEEERRSHRPK
FT                   VVHVDEHNRIVALGDDAAEPVPGVPAQLAGR"
     MRRTLMNGKI HRATVTQANL HYVGSLTIDA DLMAAADIVE GEQVQVVDVT NGARLVTYAI        60
     TGEAGSGVIG INGAAAHLVK PGDMVIIISY VALTEEERRS HRPKVVHVDE HNRIVALGDD       120
     AAEPVPGVPA QLAGR                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page